PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G531738_P01
Common NameZm.85160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 872aa    MW: 96065.9 Da    PI: 5.6795
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G531738_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.6e-1571113145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +++WT++E+ +l++a++ +G++ W+   + ++ gRt++ +k++w+
  GRMZM2G531738_P01  71 KDAWTQDEEIRLIHAHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 113
                        679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.033137IPR017930Myb domain
SuperFamilySSF466892.66E-51745IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-71845IPR009057Homeodomain-like
SuperFamilySSF466894.37E-2059122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-2161120IPR009057Homeodomain-like
PROSITE profilePS5129423.17766120IPR017930Myb domain
SMARTSM007172.5E-1370118IPR001005SANT/Myb domain
PfamPF002494.9E-1371113IPR001005SANT/Myb domain
CDDcd001673.33E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
MAVAPVVRQQ SLTEGLISCR TDVQCLHRWQ KVLNPELVKG PWSKEITTDV KHFDVTSSFR  60
WHNHLNPGIN KDAWTQDEEI RLIHAHQTYG NKWAELTKFL PGRTDNAIKN HWHSSVKKKV  120
DSYRSSGLLA QSQGFTPVEY TAGGLNVDSS SAITNQISEG SGFNVFREAE DSMELSQSSF  180
AKGSCSQEEQ NDVTLGSHLH VHESLCPDGS TNDGNGASGL PDIHHRLCTS DMDQDKHLQE  240
GMDLDKHLQH EFSQGTDLHL DVDEVPNNFV IKGSQSSNEL AVQFHDTEIM NSSKNDGVSL  300
VPHAITPCVP ILPSVSGCVH NINVIYEMGI KNDNCFQSEK CQDISIQSGA YSSEAAGSFL  360
APLYPLQTSE PAIMMGGPVY YQSSVMSLPP GFISSDGASN ASGVKSETSY YPVSRQNLEI  420
KTCHNASGDP EQNSYISSED DRNKTSEPMG RISESEKKQQ VDVEQSCLEP AACIGKEALS  480
SHGDTILSKK EDAGALCYEP PCFRSFEFPF VSCELVNSSD LPEYSPLGIR ELMRTSLNFP  540
TPVRLWGSPT RDGSPDAVLK NAAKRFMCTP SIMKKRHRDL LSPVSDIRTD KKPNTERDFM  600
SSGISSTRVG KSCMDSADDS ADLVSPKESA FQKKLKLCHE NKENLNEIAD QGENEANAKH  660
SSGILTPSSV DNHNTHKHGP NFRIQELNTT VQALSNSKDI IFSRSKPSEH VEKSAACIDA  720
DYEYLNILAD TPGIKRGLES PSAWKSPVFT PFQDAYFMSP ASRAFDALGL VKQINEQSAS  780
AVEEAHEVLA NGSPWKQHNK ENSDKENIEN TALKHEHVTS KPPSILMVEA RVLDFNECST  840
PVRKKDDKKV EIVLGGPATS PVTSSHLWIN MR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-352012039159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-352012039159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.851600.0endosperm| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G531738
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G531738_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0171280.0BT017128.1 Zea mays clone EL01N0365C01.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649477.10.0PREDICTED: uncharacterized protein LOC103630174 isoform X1
RefseqXP_008649478.10.0PREDICTED: uncharacterized protein LOC103630174 isoform X1
TrEMBLA0A096U1W40.0A0A096U1W4_MAIZE; Uncharacterized protein
STRINGGRMZM2G531738_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.23e-50Homeodomain-like protein